No Result
View All Result
Rob's Health Crunch - Helping you Lose Weight, Get Fit, Live-Well
  • Meet Rob
    • BIO
    • Reviews
  • Health Crunch
    • What’s RHC
    • Fitness
    • Keto
    • Live-Well
  • YouTube
  • Video
    • The Basics of Fitness
    • Cardio Training
    • Strength Training
    • Sprint Training
  • Blog
    • Fitness
    • Keto Carnivore
    • Live-Well
    • Mental Health
    • Travel
GET MY E-BOOKS FOR YOUR HEALTH
HEALTH CONSULTING
  • Meet Rob
    • BIO
    • Reviews
  • Health Crunch
    • What’s RHC
    • Fitness
    • Keto
    • Live-Well
  • YouTube
  • Video
    • The Basics of Fitness
    • Cardio Training
    • Strength Training
    • Sprint Training
  • Blog
    • Fitness
    • Keto Carnivore
    • Live-Well
    • Mental Health
    • Travel
No Result
View All Result
Rob's Health Crunch - Helping you Lose Weight, Get Fit, Live-Well
No Result
View All Result
Home Blog Live-Well

Here’s Why I Can Give Health, Weight Loss, Food, And Fitness Advice — I’m Trained And Have Tons Of Experience

It drives me bonkers when people with zero qualifications, history, experience, or background in "healthy living" give incorrect and misleading advice.

Rob Hourmont by Rob Hourmont
March 8, 2023
in Live-Well, Fitness, Keto Carnivore
Here’s Why I Can Give Health, Weight Loss, Food, And Fitness Advice — I’m Trained And Have Tons Of Experience

Static push-downs (not moving) - an excellent muscle-building method. Photo by Rob Hourmont

Share on FacebookShare on TwitterShare on LinkedIn

You’re not helping anyone other than yourself to get clicks!

There, I said it. These people with no background in health, weight loss, fitness, or knowledge of food publish “healthy living” stories as clickbait. They have no clue how to help you, nor do they care.

You can’t just make shit up as you go along and start posting “how to live a healthy life” stories without knowing precisely what you’re talking about. 

You must be trained and have multiple years of patient experience under your belt.

That’s how it is — so, please, “non-experts,” refrain from giving wrong health advice. You only confuse folks and lead them down the garden path.

Don’t eat a burger today — eat more salad instead!

Is that so, and how do you know that salad is healthier than beef burgers?

You don’t — that’s the problem.

1 — Beef burger patties

Ground beef only happens to be one of the most nutrient-dense foods, loaded with vital protein, fat, and sodium (an essential mineral).

2 — Salads

Raw plants are full of lectins and phytons — the plants’ natural defense mechanism, and a toxin for humans, that causes rotting gut and celiac disease.

Most salad vegetables are also quite high-carb, which converts to glucose (sugar) in your bloodstream, which helps to keep you a sugar addict and will increase your weight.

The Verdict:

A — Salads are not as healthy as you think. Promoting salads as ideal for healthy living is a scam by the food industry.

B — Beef patties are super healthy — red meat is an essential nutrient.

The winner: Beef Burgers without bread buns!

Why can I give you bang-on excellent weight loss, nutritional, and exercise advice?

Those of you who follow me know why — I’ve successfully been doing this for a long time.

Here is why I know what I’m talking about. My advice is spot on and helps everyone who follows it reach their goals.

1 — I was a professional athlete in my teens and twenties

I competed at the highest level of my sport — ski racing — and was in the Olympic Games in 1988 and multiple World Cup races.

That period in my life taught me all you need to know about how to train to be on top of your game.

Sadly, in 1990 I crashed and broke my right knee and leg. That marked the end of my skiing career.

As a result, I had to go through several years of recovery to be in reasonable shape again, which I did.

So, I know very well how to recover from injuries.

2 — I studied and became a modern nutritionist and metabolic health coach

I spent several years in my 40s suffering from being overweight and depressed. That period wasn’t fun, especially as it ended with a stroke and a divorce.

Instead of drowning in my sorrows, I took immediate action, researched, found the keto diet, and studied a detailed “nutrition and lifestyle course.”

These actions helped me lose all my excess weight in 2 to 3 months and regain lean, strong muscles.

My new life, real food, more outdoor activities, meditation, and a positive mindset helped me balance my mind and eliminate the depression.

That was 8 years ago — I’ve not been depressed or gained weight since.

3 — My experience as a metabolic health coach

 → Since starting my new career, I have developed multiple fun and easy-to-follow exercise programs.

 → I’ve personally coached hundreds of clients back to excellent metabolic and mental health.

 → I’ve written 3 E-Books on the subjects which have helped thousands find and live a better life.

 → During the last 2 years, I’ve written over 1000 online articles about health, weight loss, fitness, life lessons, self-improvement, and mental health.

I have many grateful followers across my blogs and social media profiles.

I make a point to reply to every comment I receive, be it negative (very few) or positive because I want to offer my time for free to help folks succeed.

Several followers have now become friends — we chat regularly online.

Why? Because they trust me, see their results based on my advice, and appreciate what I do for them. I enjoy talking and chatting with them too. These are highly motivated folks who don’t give up.

That, in turn, makes me happy and motivated to do more!

Final Thoughts

Guys, if you are not trained in healthy living, food, fitness, and more, please don’t advise on these topics.

People are so freaking confused, frustrated, and misled already because there is so much conflicting and bad health advice out there.

Adding your 10 cents to this complex matter doesn’t help — it does the opposite — you’re making matters worse!

Let the experts handle it.

You may be interested in these selected stories:

Your Body and Brain Do Not Need Whole Grains, Carbohydrates, And Fiber — Stop Believing The Scams

Here Is My Secret To Why I Don’t Have To Work Out Much To Maintain a Lean and Fit Body

Fifteen Thousand Steps A Day Keeps The Doctor Away!

Rob

Sign Up for Your Medium Membership here.

My top stories: Chosen Stories from Rob Hourmont’s Health Collection on Medium

Please download my E-Books for your health:

The Ultimate Guide to Weight Loss, Fitness, and Health
The Ultimate Guide to Weight Loss, Fitness, and Health. Since I’ve been practicing, writing, and teaching these methods…robshealthcrunch.gumroad.com

The Ultimate Bodyweight Workout Bible
The Ultimate Bodyweight Bible is a 200-page, 23-chapter collection of the absolute best workouts you can perform to…robshealthcrunch.gumroad.com

The Easy Keto-Carnivore Food Guide
My latest, E-Book – The Easy-Keto Carnivore Food Guide – is the only tool you’ll need to get your health into top…robshealthcrunch.gumroad.com

9 x Top Writer on Medium.

Subscribe to receive my Medium stories by email here

Share this:

  • Share on Facebook (Opens in new window) Facebook
  • Share on X (Opens in new window) X

Like this:

Like Loading...

Related

Tags: carnivorefitnessfoodhealthhealthy lifestyleketoketo foodlifelifestylelivewellmindsetnaturewellness
Rob Hourmont

Rob Hourmont

Writer, Metabolic Health Coach & Former Olympic Athlete, Modern Nutritionist. It’s my goal to Inspire, Inform and Motivate others to Live a Healthy Life by Following Natural Principles

Related Posts

Master the Headstand
Fitness

Master the Blowjob and Build a Powerful Skillset—No Gym Required

by Rob Hourmont
April 19, 2026
Beat the Weight Loss Myths
Fitness

Weight Loss Myths: Walking and Weightlifting Debunked!

by Rob Hourmont
June 5, 2025
On the beach walking in nature
Fitness

Ditch the Gym for Good: Discover Natural Paths to Wellness and Smash It!

by Rob Hourmont
June 4, 2025
Beautiful woman on the beach
Live-Well

Attacked in Pattaya For Just Chatting With a Beautiful Woman! Why?

by Rob Hourmont
April 15, 2026
My Government Left Me Stranded!
Live-Well

My Government Left Me Stranded Without a Passport 7000 Miles Away – The British Home Office Bears The Blame

by Rob Hourmont
February 10, 2025

RECENT

My Government Left Me Stranded Without a Passport 7000 Miles Away – The British Home Office Bears The Blame

by Rob Hourmont
February 10, 2025
My Government Left Me Stranded!

Did Social Media Hackers or Scammers do this, or were Locals in Cambodia involved? I've since learned that many social...

Read more

The Biggest Food Lie? “There Are No Bad Foods”

by Rob Hourmont
February 6, 2025
Food Lies.

I've practiced "healthy and sustainable living" by eating real food for the past 10 years. I have also coached thousands...

Read more

Why Keto is The Best Anti-Inflammatory Diet (Key Benefits of Keto)

by Rob Hourmont
February 3, 2025
Keto is the best anti-inflammatory diet

Here's why the keto diet is the best anti-inflammatory diet. If you follow my advice, you will experience an amazing...

Read more

Questions or Comments





    • Contacts
    • Bio
    • Privacy Policy
    • Terms & Conditions

    © 2021 Robs Health Crunch All Rights Reserved.

    No Result
    View All Result
    • Meet Rob
      • BIO
      • Reviews
    • Health Crunch
      • What’s RHC
      • Fitness
      • Keto
      • Live-Well
    • YouTube
    • Video
      • The Basics of Fitness
      • Cardio Training
      • Strength Training
      • Sprint Training
    • Blog
      • Fitness
      • Keto Carnivore
      • Live-Well
      • Mental Health
      • Travel

    © 2021 Robs Health Crunch All Rights Reserved.

    Welcome Back!

    Login to your account below

    Forgotten Password?

    Create New Account!

    Fill the forms below to register

    *By registering into our website, you agree to the Terms & Conditions and Privacy Policy.
    All fields are required. Log In

    Retrieve your password

    Please enter your username or email address to reset your password.

    Log In

    Add New Playlist

    This website uses cookies. By continuing to use this website you are giving consent to cookies being used. Visit our Privacy and Cookie Policy.

    Discover more from Rob's Health Munch

    Subscribe now to keep reading and get access to the full archive.

    Continue reading

    %d
      Verified by MonsterInsights